CAD antibody (N-Term)
-
- Target See all CAD Antibodies
- CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CAD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CAD antibody was raised against the N terminal of CAD
- Purification
- Affinity purified
- Immunogen
- CAD antibody was raised using the N terminal of CAD corresponding to a region with amino acids AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV
- Top Product
- Discover our top product CAD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CAD Blocking Peptide, catalog no. 33R-1037, is also available for use as a blocking control in assays to test for specificity of this CAD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))
- Alternative Name
- CAD (CAD Products)
- Synonyms
- Cpad antibody, AU018859 antibody, 2410008J01Rik antibody, cb456 antibody, wu:fc30c12 antibody, wu:fc33d01 antibody, wu:fc67g02 antibody, si:dkey-221h15.3 antibody, CAD antibody, xcad antibody, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase antibody, CAD antibody, Cad antibody, cad antibody
- Background
- CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.
- Molecular Weight
- 243 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process
-