IMPDH1 antibody

Catalog No. ABIN630628

Product Details anti-IMPDH1 Antibody

Target: IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IMPDH1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: IMPDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IMPDH1 Blocking Peptide, catalog no. 33R-4468, is also available for use as a blocking control in assays to test for specificity of this IMPDH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IMPDH1

Target: IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))

Alternative Name: IMPDH1 (IMPDH1 Products)

Synonyms: IMPD antibody, IMPD1 antibody, LCA11 antibody, RP10 antibody, sWSS2608 antibody, B930086D20Rik antibody, IMPD 1 antibody, IMPDH 1 antibody, D3 antibody, IMPD 1b antibody, IMPDH 1b antibody, IMPDH1 antibody, id:ibd5035 antibody, si:dkey-31f5.7 antibody, wu:fa09h11 antibody, wu:fa99c03 antibody, zgc:113446 antibody, imp antibody, imp1 antibody, imp2 antibody, IMPD 1a antibody, IMPDH 1a antibody, zgc:91911 antibody, inosine monophosphate dehydrogenase 1 antibody, inosine-5'-monophosphate dehydrogenase 1 antibody, IMP (inosine 5'-monophosphate) dehydrogenase 1b antibody, IMP (inosine 5'-monophosphate) dehydrogenase 1 antibody, IMP (inosine 5'-monophosphate) dehydrogenase 1a antibody, IMPDH1 antibody, Impdh1 antibody, LOC100442769 antibody, impdh1 antibody, impdh1b antibody, impdh1.L antibody, impdh1a antibody

Background: IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).

Molecular Weight: 62 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process