IMPDH1 antibody
-
- Target See all IMPDH1 Antibodies
- IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IMPDH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- IMPDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE
- Top Product
- Discover our top product IMPDH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IMPDH1 Blocking Peptide, catalog no. 33R-4468, is also available for use as a blocking control in assays to test for specificity of this IMPDH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))
- Alternative Name
- IMPDH1 (IMPDH1 Products)
- Synonyms
- IMPD antibody, IMPD1 antibody, LCA11 antibody, RP10 antibody, sWSS2608 antibody, B930086D20Rik antibody, IMPD 1 antibody, IMPDH 1 antibody, D3 antibody, IMPD 1b antibody, IMPDH 1b antibody, IMPDH1 antibody, id:ibd5035 antibody, si:dkey-31f5.7 antibody, wu:fa09h11 antibody, wu:fa99c03 antibody, zgc:113446 antibody, imp antibody, imp1 antibody, imp2 antibody, IMPD 1a antibody, IMPDH 1a antibody, zgc:91911 antibody, inosine monophosphate dehydrogenase 1 antibody, inosine-5'-monophosphate dehydrogenase 1 antibody, IMP (inosine 5'-monophosphate) dehydrogenase 1b antibody, IMP (inosine 5'-monophosphate) dehydrogenase 1 antibody, IMP (inosine 5'-monophosphate) dehydrogenase 1a antibody, IMPDH1 antibody, Impdh1 antibody, LOC100442769 antibody, impdh1 antibody, impdh1b antibody, impdh1.L antibody, impdh1a antibody
- Background
- IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).
- Molecular Weight
- 62 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-