ACTR1B antibody

Catalog No. ABIN630653

Product Details anti-ACTR1B Antibody

Target: ACTR1B (ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (ACTR1B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTR1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ACTR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTR1B Blocking Peptide, catalog no. 33R-4434, is also available for use as a blocking control in assays to test for specificity of this ACTR1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTR1B

Target: ACTR1B (ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (ACTR1B))

Alternative Name: ACTR1B (ACTR1B Products)

Synonyms: ARP1B antibody, CTRN2 antibody, PC3 antibody, 2310066K23Rik antibody, AA960180 antibody, AI851923 antibody, Arp1b antibody, ACTR1B antibody, ARP1 actin related protein 1 homolog B antibody, ARP1 actin-related protein 1B, centractin beta antibody, ARP1 actin-related protein 1 homolog B antibody, ARP1 actin-related protein 1 homolog B, centractin beta (yeast) antibody, beta-centractin antibody, ACTR1B antibody, Actr1b antibody, LOC100594459 antibody

Background: ACTR1B is a 42.3 kDa subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis.

Molecular Weight: 42 kDa (MW of target protein)