TTC5 antibody (C-Term)

Catalog No. ABIN630694

Product Details anti-TTC5 Antibody

Target: TTC5 (Tetratricopeptide Repeat Domain 5 (TTC5))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TTC5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TTC5 antibody was raised against the C terminal of TTC5

Purification: Affinity purified

Immunogen: TTC5 antibody was raised using the C terminal of TTC5 corresponding to a region with amino acids GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TTC5 Blocking Peptide, catalog no. 33R-3213, is also available for use as a blocking control in assays to test for specificity of this TTC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TTC5

Target: TTC5 (Tetratricopeptide Repeat Domain 5 (TTC5))

Alternative Name: TTC5 (TTC5 Products)

Synonyms: TTC5 antibody, ttc5 antibody, wu:fi33h05 antibody, wu:fy81e07 antibody, zgc:112059 antibody, Strap antibody, 5930437N14 antibody, AW743060 antibody, tetratricopeptide repeat domain 5 L homeolog antibody, tetratricopeptide repeat domain 5 antibody, ttc5.L antibody, TTC5 antibody, ttc5 antibody, Ttc5 antibody

Background: TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Chromatin Binding