Peroxiredoxin 3 antibody (N-Term)

Catalog No. ABIN630744

Product Details anti-Peroxiredoxin 3 Antibody

Target: Peroxiredoxin 3 (PRDX3)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peroxiredoxin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Peroxiredoxin 3 antibody was raised against the N terminal of PRDX3

Purification: Affinity purified

Immunogen: Peroxiredoxin 3 antibody was raised using the N terminal of PRDX3 corresponding to a region with amino acids AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Peroxiredoxin 3 Blocking Peptide, catalog no. 33R-1279, is also available for use as a blocking control in assays to test for specificity of this Peroxiredoxin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of Peroxiredoxin 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peroxiredoxin 3

Target: Peroxiredoxin 3 (PRDX3)

Alternative Name: Peroxiredoxin 3 (PRDX3 Products)

Synonyms: cb718 antibody, wu:fk49e09 antibody, zgc:110282 antibody, zgc:112512 antibody, MGC83969 antibody, PRDX3 antibody, AOP-1 antibody, AOP1 antibody, HBC189 antibody, MER5 antibody, PRO1748 antibody, SP-22 antibody, prx-III antibody, AW822249 antibody, Aop1 antibody, D0Tohi1 antibody, Ef2l antibody, Mer5 antibody, Prx3 antibody, SP22 antibody, TDXM antibody, MTAP antibody, peroxiredoxin 3 antibody, peroxiredoxin 3 S homeolog antibody, peroxiredoxin PRX3 antibody, prdx3 antibody, PRDX3 antibody, prdx3.S antibody, PRX3 antibody, Prdx3 antibody

Background: PRDX3 is a protein with antioxidant function and is localized in the mitochondrion. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process