APPBP2 antibody
-
- Target See all APPBP2 Antibodies
- APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APPBP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- APPBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN
- Top Product
- Discover our top product APPBP2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
APPBP2 Blocking Peptide, catalog no. 33R-7479, is also available for use as a blocking control in assays to test for specificity of this APPBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APPBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))
- Alternative Name
- APPBP2 (APPBP2 Products)
- Synonyms
- HS.84084 antibody, PAT1 antibody, 1300003O07Rik antibody, AI465480 antibody, zgc:76971 antibody, wu:fb78e11 antibody, wu:fc25c09 antibody, APPBP2 antibody, DKFZp459F0530 antibody, amyloid beta precursor protein binding protein 2 antibody, amyloid beta precursor protein (cytoplasmic tail) binding protein 2 antibody, amyloid beta precursor protein (cytoplasmic tail) binding protein 2 S homeolog antibody, APPBP2 antibody, Appbp2 antibody, appbp2 antibody, appbp2.S antibody
- Background
- APPBP2 interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. APPBP2 has been found to be highly expressed in breast cancer.
- Molecular Weight
- 67 kDa (MW of target protein)
-