EPH Receptor A5 antibody (Middle Region)
-
- Target See all EPH Receptor A5 (EPHA5) Antibodies
- EPH Receptor A5 (EPHA5)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EPH Receptor A5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Eph Receptor A5 antibody was raised against the middle region of EPHA5
- Purification
- Affinity purified
- Immunogen
- Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP
- Top Product
- Discover our top product EPHA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Eph Receptor A5 Blocking Peptide, catalog no. 33R-8364, is also available for use as a blocking control in assays to test for specificity of this Eph Receptor A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EPH Receptor A5 (EPHA5)
- Alternative Name
- Eph Receptor A5 (EPHA5 Products)
- Synonyms
- CEK7 antibody, EHK-1 antibody, EHK1 antibody, EK7 antibody, HEK7 antibody, TYRO4 antibody, AI854630 antibody, AW125296 antibody, Cek7 antibody, Ehk1 antibody, Els1 antibody, Hek7 antibody, Rek7 antibody, bsk antibody, Els1. antibody, EPHA5 antibody, EPH receptor A5 antibody, Eph receptor A5 antibody, EPHA5 antibody, epha5 antibody, Epha5 antibody
- Background
- EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 114 kDa (MW of target protein)
- Pathways
- RTK Signaling
-