Dnmt2 antibody (N-Term)

Catalog No. ABIN630813

Product Details anti-Dnmt2 Antibody

Target: Dnmt2 (TRDMT1) (tRNA Aspartic Acid Methyltransferase 1 (TRDMT1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Dnmt2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRDMT1 antibody was raised against the N terminal of TRDMT1

Purification: Affinity purified

Immunogen: TRDMT1 antibody was raised using the N terminal of TRDMT1 corresponding to a region with amino acids MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRDMT1 Blocking Peptide, catalog no. 33R-6114, is also available for use as a blocking control in assays to test for specificity of this TRDMT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRDMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Dnmt2

Target: Dnmt2 (TRDMT1) (tRNA Aspartic Acid Methyltransferase 1 (TRDMT1))

Alternative Name: TRDMT1 (TRDMT1 Products)

Synonyms: MGC89267 antibody, DMNT2 antibody, DNMT2 antibody, MHSAIIP antibody, PUMET antibody, RNMT1 antibody, Dnmt2 antibody, Rnmt2 antibody, dnmt2 antibody, tRNA aspartic acid methyltransferase 1 antibody, tRNA aspartic acid methyltransferase 1 L homeolog antibody, trdmt1 antibody, TRDMT1 antibody, Trdmt1 antibody, trdmt1.L antibody

Background: CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. TRDMT1 is a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity.

Molecular Weight: 44 kDa (MW of target protein)