FKBP5 antibody (C-Term)

Catalog No. ABIN630950

Product Details anti-FKBP5 Antibody

Target: FKBP5 (FK506 Binding Protein 5 (FKBP5))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FKBP5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FKBP5 antibody was raised against the C terminal of FKBP5

Purification: Affinity purified

Immunogen: FKBP5 antibody was raised using the C terminal of FKBP5 corresponding to a region with amino acids CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FKBP5 Blocking Peptide, catalog no. 33R-1834, is also available for use as a blocking control in assays to test for specificity of this FKBP5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FKBP5

Target: FKBP5 (FK506 Binding Protein 5 (FKBP5))

Alternative Name: FKBP5 (FKBP5 Products)

Synonyms: FKBP5 antibody, FKBP-5 antibody, AIG6 antibody, FKBP51 antibody, FKBP54 antibody, P54 antibody, PPIase antibody, Ptg-10 antibody, D17Ertd592e antibody, Dit1 antibody, si:zc263a23.8 antibody, wu:fc31g11 antibody, wu:fl87b03 antibody, zgc:64082 antibody, FK506 binding protein 5 antibody, FKBP5 antibody, fkbp5 antibody, Fkbp5 antibody

Background: FKBP5 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. It is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein.

Molecular Weight: 51 kDa (MW of target protein)