PSMA2 antibody
-
- Target See all PSMA2 Antibodies
- PSMA2 (Proteasome Subunit alpha 2 (PSMA2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV
- Top Product
- Discover our top product PSMA2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMA2 Blocking Peptide, catalog no. 33R-9560, is also available for use as a blocking control in assays to test for specificity of this PSMA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMA2 (Proteasome Subunit alpha 2 (PSMA2))
- Alternative Name
- PSMA2 (PSMA2 Products)
- Synonyms
- Lmpc3 antibody, wu:faa49c06 antibody, wu:fb98h03 antibody, zgc:110710 antibody, HC3 antibody, MU antibody, PMSA2 antibody, PSC2 antibody, proteasome (prosome, macropain) subunit, alpha type 2 antibody, proteasome subunit alpha 2 antibody, proteasome subunit alpha 2 L homeolog antibody, Psma2 antibody, psma2 antibody, psma2.L antibody, PSMA2 antibody
- Background
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA2 is a member of the peptidase T1A family, that is a 20S core alpha subunit.
- Molecular Weight
- 26 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-