PSMA2 antibody

Catalog No. ABIN630966

Product Details anti-PSMA2 Antibody

Target: PSMA2 (Proteasome Subunit alpha 2 (PSMA2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMA2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PSMA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMA2 Blocking Peptide, catalog no. 33R-9560, is also available for use as a blocking control in assays to test for specificity of this PSMA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMA2

Target: PSMA2 (Proteasome Subunit alpha 2 (PSMA2))

Alternative Name: PSMA2 (PSMA2 Products)

Synonyms: Lmpc3 antibody, wu:faa49c06 antibody, wu:fb98h03 antibody, zgc:110710 antibody, HC3 antibody, MU antibody, PMSA2 antibody, PSC2 antibody, proteasome (prosome, macropain) subunit, alpha type 2 antibody, proteasome subunit alpha 2 antibody, proteasome subunit alpha 2 L homeolog antibody, Psma2 antibody, psma2 antibody, psma2.L antibody, PSMA2 antibody

Background: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA2 is a member of the peptidase T1A family, that is a 20S core alpha subunit.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA