CDT2/RAMP antibody
-
- Target See all CDT2/RAMP (DTL) Antibodies
- CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDT2/RAMP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DTL antibody was raised using a synthetic peptide corresponding to a region with amino acids VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV
- Top Product
- Discover our top product DTL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DTL Blocking Peptide, catalog no. 33R-9712, is also available for use as a blocking control in assays to test for specificity of this DTL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))
- Alternative Name
- DTL (DTL Products)
- Synonyms
- CDT2 antibody, DCAF2 antibody, L2DTL antibody, RAMP antibody, 2810047L02Rik antibody, 5730564G15Rik antibody, Ramp antibody, RGD1310439 antibody, cdt2 antibody, cdt2-a antibody, dcaf2 antibody, l2dtl antibody, ramp antibody, cb151 antibody, chunp6871 antibody, wu:fb54b02 antibody, denticleless E3 ubiquitin protein ligase homolog antibody, denticleless E3 ubiquitin protein ligase antibody, denticleless E3 ubiquitin protein ligase homolog S homeolog antibody, denticleless E3 ubiquitin protein ligase homolog (Drosophila) antibody, DTL antibody, Dtl antibody, dtl.S antibody, dtl antibody
- Background
- DTL is required for CDT1 proteolysis in response to DNA damage through the CUL4-DDB1 E3 ubiquitin-protein ligase. It seems to be necessary to ensure proper cell cycle regulation of DNA replication. DTL may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. It also may play a role in cell proliferation of NT2 embryonal carcinoma cells.
- Molecular Weight
- 79 kDa (MW of target protein)
-