PDK2 antibody (Middle Region)

Catalog No. ABIN631027

This Rabbit Polyclonal antibody specifically detects PDK2 in WB. It exhibits reactivity toward Human.

Quick Overview for PDK2 antibody (Middle Region) (ABIN631027)

Target: PDK2 (Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDK2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDK2 Antibody

Binding Specificity: Middle Region

Specificity: PDK2 antibody was raised against the middle region of PDK2

Purification: Affinity purified

Immunogen: PDK2 antibody was raised using the middle region of PDK2 corresponding to a region with amino acids ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDK2 Blocking Peptide, (ABIN937927), is also available for use as a blocking control in assays to test for specificity of this PDK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDK2

Target: PDK2 (Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2))

Alternative Name: PDK2

Background: PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling, RTK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effect