PPM1K antibody
-
- Target See all PPM1K Antibodies
- PPM1K (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPM1K antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPM1 K antibody was raised using a synthetic peptide corresponding to a region with amino acids AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA
- Top Product
- Discover our top product PPM1K Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPM1K Blocking Peptide, catalog no. 33R-1241, is also available for use as a blocking control in assays to test for specificity of this PPM1K antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPM1K (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K))
- Alternative Name
- PPM1K (PPM1K Products)
- Synonyms
- 2900063A19Rik antibody, A930026L03Rik antibody, PP2Cm antibody, im:6912645 antibody, zgc:113207 antibody, BDP antibody, MSUDMV antibody, PP2Ckappa antibody, PTMP antibody, UG0882E07 antibody, RGD1308501 antibody, protein phosphatase 1K (PP2C domain containing) antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1K antibody, protein phosphatase, Mg2+/Mn2+ dependent 1K antibody, protein phosphatase, Mg2+/Mn2+ dependent 1K S homeolog antibody, Ppm1k antibody, ppm1k antibody, PPM1K antibody, ppm1k.S antibody
- Background
- PPM1K regulates the mitochondrial permeability transition pore and is essential for cellular survival and development.
- Molecular Weight
- 41 kDa (MW of target protein)
-