LRP1 antibody

Catalog No. ABIN631053

Product Details anti-LRP1 Antibody

Target: LRP1 (Low Density Lipoprotein Receptor-Related Protein 1 (LRP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LRP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRP1 Blocking Peptide, catalog no. 33R-1577, is also available for use as a blocking control in assays to test for specificity of this LRP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRP1

Target: LRP1 (Low Density Lipoprotein Receptor-Related Protein 1 (LRP1))

Alternative Name: LRP1 (LRP1 Products)

Synonyms: A2MR antibody, APOER antibody, APR antibody, CD91 antibody, IGFBP3R antibody, LRP antibody, LRP1A antibody, TGFBR5 antibody, A2mr antibody, AI316852 antibody, Lrp antibody, LRP-1 antibody, LDL receptor related protein 1 antibody, prolow-density lipoprotein receptor-related protein 1 antibody, low density lipoprotein receptor-related protein 1 antibody, LRP1 antibody, Lrp1 antibody, LOC100414789 antibody

Background: Low-density lipoprotein receptor-related protein 1 (-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling