VPS28 antibody

Catalog No. ABIN631062

Product Details anti-VPS28 Antibody

Target: VPS28 (Vacuolar Protein Sorting 28 (VPS28))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS28 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: VPS28 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS28 Blocking Peptide, catalog no. 33R-5993, is also available for use as a blocking control in assays to test for specificity of this VPS28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS28

Target: VPS28 (Vacuolar Protein Sorting 28 (VPS28))

Alternative Name: VPS28 (VPS28 Products)

Synonyms: CG12770 antibody, DmVps28 antibody, Dmel\\CG12770 antibody, Dvps28 antibody, ESCRT-I antibody, ESCRT-II antibody, dVps28 antibody, dvps28 antibody, l(2)k16503 antibody, vps28 antibody, VPS28 antibody, GB12925 antibody, VPL13 antibody, VPT28 antibody, DDBDRAFT_0186436 antibody, DDBDRAFT_0234023 antibody, DDB_0186436 antibody, DDB_0234023 antibody, 1110014J03Rik antibody, AI847241 antibody, D730005C08Rik antibody, zgc:66078 antibody, Vacuolar protein sorting 28 antibody, VPS28, ESCRT-I subunit antibody, vacuolar protein sorting 28 homolog antibody, vacuolar protein sorting-associated protein 28 homolog antibody, ESCRT-I subunit protein VPS28 antibody, ESCRT I complex subunit Vps28 antibody, transport of soluble vacuolar hydrolase precursors antibody, subunit of the ESCRT-I complex antibody, vacuolar protein sorting-associated protein antibody, vacuolar protein sorting 28 family protein antibody, vacuolar protein sorting-associated protein 28 antibody, Vacuolar protein sorting-associated protein 28 homolog antibody, vacuolar protein sorting 28 antibody, vacuolar protein sorting 28 (yeast) antibody, vacuolar protein sorting 28 homolog S homeolog antibody, Vps28 antibody, VPS28 antibody, vps28 antibody, LOC408783 antibody, CpipJ_CPIJ003920 antibody, LACBIDRAFT_399656 antibody, PTRG_04781 antibody, MCYG_00028 antibody, PITG_04534 antibody, Tsp_08691 antibody, Tsp_08687 antibody, Tsp_08688 antibody, vps-28 antibody, vps28.S antibody

Background: This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway.

Molecular Weight: 25 kDa (MW of target protein)