CYP11A1 antibody (N-Term)
-
- Target See all CYP11A1 Antibodies
- CYP11A1 (Cytochrome P450, Family 11, Subfamily A, Polypeptide 1 (CYP11A1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP11A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP11 A1 antibody was raised against the N terminal of CYP11 1
- Purification
- Affinity purified
- Immunogen
- CYP11 A1 antibody was raised using the N terminal of CYP11 1 corresponding to a region with amino acids QKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHL
- Top Product
- Discover our top product CYP11A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP11A1 Blocking Peptide, catalog no. 33R-7603, is also available for use as a blocking control in assays to test for specificity of this CYP11A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP11A1 (Cytochrome P450, Family 11, Subfamily A, Polypeptide 1 (CYP11A1))
- Alternative Name
- CYP11A1 (CYP11A1 Products)
- Synonyms
- CYP11A antibody, CYP11A1 antibody, CYPXIA1 antibody, P450SCC antibody, Cyp11a antibody, Cypxia1 antibody, D9Ertd411e antibody, P450scc antibody, Scc antibody, cscc antibody, P450(scc) antibody, SSC antibody, cytochrome P450 family 11 subfamily A member 1 antibody, cholesterol side-chain cleavage enzyme, mitochondrial-like antibody, cytochrome P450 cholesterol side-chain cleavage antibody, cytochrome P450, family 11, subfamily a, polypeptide 1 antibody, cytochrome P450, family 11, subfamily A, polypeptide 1 antibody, CYP11A1 antibody, LOC101827747 antibody, Cyp11a1 antibody
- Background
- CYP11A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP11A1 localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. This gene encodes a member of the cytochrome P450 superfamily of enzymes.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin
-