MTRF1L antibody (N-Term)
-
- Target See all MTRF1L Antibodies
- MTRF1L (Mitochondrial Translational Release Factor 1-Like (MTRF1L))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MTRF1L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MTRF1 L antibody was raised against the N terminal of MTRF1
- Purification
- Affinity purified
- Immunogen
- MTRF1 L antibody was raised using the N terminal of MTRF1 corresponding to a region with amino acids MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQ
- Top Product
- Discover our top product MTRF1L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MTRF1L Blocking Peptide, catalog no. 33R-6384, is also available for use as a blocking control in assays to test for specificity of this MTRF1L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTRF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTRF1L (Mitochondrial Translational Release Factor 1-Like (MTRF1L))
- Alternative Name
- MTRF1L (MTRF1L Products)
- Synonyms
- fj59e12 antibody, wu:fj59e12 antibody, si:dkeyp-9b4.2 antibody, HMRF1L antibody, MRF1L antibody, mtRF1a antibody, 9130004K12Rik antibody, mitochondrial translational release factor 1 like antibody, mitochondrial translational release factor 1-like antibody, MTRF1L antibody, mtrf1l antibody, Mtrf1l antibody
- Background
- MTRF1L is a mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.
- Molecular Weight
- 30 kDa (MW of target protein)
-