HAX1 antibody (Middle Region)
-
- Target See all HAX1 Antibodies
- HAX1 (HCLS1 Associated Protein X-1 (HAX1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HAX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HAX1 antibody was raised against the middle region of HAX1
- Purification
- Affinity purified
- Immunogen
- HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP
- Top Product
- Discover our top product HAX1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HAX1 Blocking Peptide, catalog no. 33R-5266, is also available for use as a blocking control in assays to test for specificity of this HAX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HAX1 (HCLS1 Associated Protein X-1 (HAX1))
- Alternative Name
- HAX1 (HAX1 Products)
- Synonyms
- HAX1 antibody, hax1 antibody, HCLSBP1 antibody, HS1BP1 antibody, SCN3 antibody, HAX-1 antibody, Hs1bp1 antibody, HSP1BP-1 antibody, SIG-111 antibody, Silg111 antibody, mHAX-1s antibody, HCLS1 associated protein X-1 antibody, HCLS1 associated X-1 antibody, HAX1 antibody, hax1 antibody, Hax1 antibody
- Background
- HAX1 is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease.
- Molecular Weight
- 31 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-