Adipsin antibody (N-Term)
-
- Target See all Adipsin (CFD) Antibodies
- Adipsin (CFD) (Complement Factor D (CFD))
-
Binding Specificity
- N-Term
-
Reactivity
- Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Adipsin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EVE antibody was raised against the N terminal Of Eve
- Purification
- Affinity purified
- Immunogen
- EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS
- Top Product
- Discover our top product CFD Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EVE Blocking Peptide, catalog no. 33R-6092, is also available for use as a blocking control in assays to test for specificity of this EVE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Adipsin (CFD) (Complement Factor D (CFD))
- Alternative Name
- EVE (CFD Products)
- Synonyms
- ADIPSIN antibody, ADN antibody, DF antibody, PFD antibody, Adn antibody, Df antibody, EVE antibody, CFD antibody, adipsin antibody, pfd antibody, cfdl antibody, wu:fb61f12 antibody, zgc:109940 antibody, 10.5 antibody, 10.9 antibody, 14.10 antibody, 20.35 antibody, CG2328 antibody, Dmel\\CG2328 antibody, E(eve) antibody, Eve antibody, F antibody, V antibody, VI antibody, eve2 antibody, even antibody, l(2)46CFg antibody, l(2)46CFh antibody, l(2)46CFj antibody, l(2)46CFp antibody, l(2)46Ce antibody, l(2)46Cg antibody, complement factor D antibody, complement factor D (adipsin) antibody, complement factor D (adipsin) L homeolog antibody, even skipped antibody, CFD antibody, Cfd antibody, cfd.L antibody, cfd antibody, eve antibody
- Background
- Eve may play a role in determining neuronal identity. It may be directly involved in specifying identity of individual neurons. It is a pair-rule protein required for segmentation, involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Complement System
-