CA8 antibody (Middle Region)
-
- Target See all CA8 Antibodies
- CA8 (Carbonic Anhydrase VIII (CA8))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CA8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Carbonic Anhydrase VIII antibody was raised against the middle region of CA8
- Purification
- Affinity purified
- Immunogen
- Carbonic Anhydrase VIII antibody was raised using the middle region of CA8 corresponding to a region with amino acids TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
- Top Product
- Discover our top product CA8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carbonic Anhydrase VIII Blocking Peptide, catalog no. 33R-9129, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase VIII antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CA8 (Carbonic Anhydrase VIII (CA8))
- Alternative Name
- Carbonic Anhydrase VIII (CA8 Products)
- Synonyms
- AW546993 antibody, Ca8 antibody, Cals antibody, Cals1 antibody, Carp antibody, wdl antibody, zgc:110118 antibody, CA-VIII antibody, CALS antibody, CAMRQ3 antibody, CARP antibody, carbonic anhydrase 8 antibody, carbonic anhydrase VIII antibody, CAH8 antibody, Car8 antibody, ca8 antibody, CA8 antibody
- Background
- CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.
- Molecular Weight
- 33 kDa (MW of target protein)
-