PYGB antibody (N-Term)
-
- Target See all PYGB (GPBB) Antibodies
- PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PYGB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PYGB antibody was raised against the N terminal of PYGB
- Purification
- Affinity purified
- Immunogen
- PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT
- Top Product
- Discover our top product GPBB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PYGB Blocking Peptide, catalog no. 33R-1085, is also available for use as a blocking control in assays to test for specificity of this PYGB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYGB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))
- Alternative Name
- PYGB (GPBB Products)
- Synonyms
- GPBB antibody, GLYPHOA antibody, glycogen phosphorylase B antibody, phosphorylase, glycogen; brain antibody, brain glycogen phosphorylase antibody, phosphorylase, glycogen; brain S homeolog antibody, PYGB antibody, pygb antibody, Pygb antibody, pygb.S antibody
- Background
- PYGB is a glycogen phosphorylase found predominantly in the brain. It forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation.
- Molecular Weight
- 97 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-