DSTYK antibody (Middle Region)
-
- Target See all DSTYK Antibodies
- DSTYK (Dual serine/threonine and tyrosine Protein Kinase (DSTYK))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DSTYK antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RIPK5 antibody was raised against the middle region of RIPK5
- Purification
- Affinity purified
- Immunogen
- RIPK5 antibody was raised using the middle region of RIPK5 corresponding to a region with amino acids EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS
- Top Product
- Discover our top product DSTYK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RIPK5 Blocking Peptide, catalog no. 33R-2341, is also available for use as a blocking control in assays to test for specificity of this RIPK5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIPK5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DSTYK (Dual serine/threonine and tyrosine Protein Kinase (DSTYK))
- Alternative Name
- RIPK5 (DSTYK Products)
- Synonyms
- CAKUT1 antibody, DustyPK antibody, RIP5 antibody, RIPK5 antibody, A930019K20Rik antibody, C430014H23Rik antibody, C820013G01 antibody, Ripk5 antibody, ripk5 antibody, zgc:136421 antibody, DSTYK antibody, GB11994 antibody, DUSTYPK antibody, dual serine/threonine and tyrosine protein kinase antibody, receptor interacting protein kinase 5 antibody, dual serine/threonine and tyrosine protein kinase S homeolog antibody, DSTYK antibody, Dstyk antibody, dstyk antibody, Ripk5 antibody, dstyk.S antibody
- Background
- RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.
- Molecular Weight
- 100 kDa (MW of target protein)
-