PRAME antibody (N-Term)
-
- Target See all PRAME Antibodies
- PRAME (Preferentially Expressed Antigen in Melanoma (PRAME))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRAME antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRAME antibody was raised against the N terminal of PRAME
- Purification
- Affinity purified
- Immunogen
- PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
- Top Product
- Discover our top product PRAME Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRAME Blocking Peptide, catalog no. 33R-1390, is also available for use as a blocking control in assays to test for specificity of this PRAME antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRAME antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRAME (Preferentially Expressed Antigen in Melanoma (PRAME))
- Alternative Name
- PRAME (PRAME Products)
- Synonyms
- PRAME antibody, CT130 antibody, MAPE antibody, OIP-4 antibody, OIP4 antibody, 4930534P07Rik antibody, preferentially expressed antigen in melanoma antibody, PRAME antibody, Prame antibody
- Background
- PRAME functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. PRAME prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Retinoic Acid Receptor Signaling Pathway, Nuclear Hormone Receptor Binding
-