CSNK2A1/CK II alpha antibody (Middle Region)
-
- Target See all CSNK2A1/CK II alpha (CSNK2A1) Antibodies
- CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Drosophila melanogaster, C. elegans
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CSNK2A1/CK II alpha antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CK2 alpha 1 antibody was raised against the middle region of CSNK2 A1
- Purification
- Affinity purified
- Immunogen
- CK2 alpha 1 antibody was raised using the middle region of CSNK2 A1 corresponding to a region with amino acids LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP
- Top Product
- Discover our top product CSNK2A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CK2 alpha 1 Blocking Peptide, catalog no. 33R-4966, is also available for use as a blocking control in assays to test for specificity of this CK2 alpha 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))
- Abstract
- CSNK2A1 Products
- Synonyms
- CK2A2 antibody, CSNK2A1 antibody, CK2A1 antibody, CKII antibody, CSNK2A3 antibody, CK2A antibody, Ck2a antibody, BmCK2a antibody, wu:fi38e04 antibody, wu:fi38h03 antibody, csnk2a1 antibody, CK-II antibody, CK2 antibody, Ckiialpha antibody, Csnk2a1-rs4 antibody, ck2a1 antibody, casein kinase 2 alpha 2 antibody, casein kinase 2 alpha 1 antibody, casein kinase 2 alpha subunit antibody, casein kinase 2, alpha 1 polypeptide antibody, CK2 protein kinase alpha 2 antibody, casein kinase II alpha subunit antibody, Casein kinase II alpha subunit antibody, casein kinase 2, alpha 1 polypeptide S homeolog antibody, CSNK2A2 antibody, CSNK2A1 antibody, ck2a antibody, Ck2a antibody, csnk2a1 antibody, cka2 antibody, Ckiialpha antibody, CK2A1 antibody, Csnk2a1 antibody, csnk2a1.S antibody
- Background
- Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. CSNK2A1 represents the alpha subunit.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-