APPL1 antibody (Middle Region)
-
- Target See all APPL1 Antibodies
- APPL1 (Adaptor Protein, phosphotyrosine Interaction, PH Domain and Leucine Zipper Containing 1 (APPL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APPL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- APPL1 antibody was raised against the middle region of APPL1
- Purification
- Affinity purified
- Immunogen
- APPL1 antibody was raised using the middle region of APPL1 corresponding to a region with amino acids GQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDD
- Top Product
- Discover our top product APPL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
APPL1 Blocking Peptide, catalog no. 33R-3487, is also available for use as a blocking control in assays to test for specificity of this APPL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APPL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APPL1 (Adaptor Protein, phosphotyrosine Interaction, PH Domain and Leucine Zipper Containing 1 (APPL1))
- Alternative Name
- APPL1 (APPL1 Products)
- Synonyms
- APPL antibody, DIP13alpha antibody, 2900057D21Rik antibody, 7330406P05Rik antibody, AI585782 antibody, AW209077 antibody, BB022931 antibody, C88264 antibody, DIP13 antibody, RGD1309388 antibody, adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 antibody, adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 antibody, APPL1 antibody, Appl1 antibody
- Background
- The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A.
- Molecular Weight
- 80 kDa (MW of target protein)
-