FBXW11 antibody (N-Term)
-
- Target See all FBXW11 Antibodies
- FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXW11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXW11 antibody was raised against the N terminal of FBXW11
- Purification
- Affinity purified
- Immunogen
- FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRP
- Top Product
- Discover our top product FBXW11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXW11 Blocking Peptide, catalog no. 33R-2627, is also available for use as a blocking control in assays to test for specificity of this FBXW11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))
- Alternative Name
- FBXW11 (FBXW11 Products)
- Synonyms
- BTRC2 antibody, BTRCP2 antibody, FBW1B antibody, FBXW1B antibody, Fbw11 antibody, Hos antibody, 2310065A07Rik antibody, AA536858 antibody, Fbxw1b antibody, HOS antibody, btrc2 antibody, fbxw11a antibody, wu:fa12e12 antibody, wu:fb11f03 antibody, zgc:63728 antibody, fbxw11 antibody, fbxw11b antibody, fbxw1b antibody, wu:fd14d12 antibody, wu:fi43f07 antibody, F-box and WD repeat domain containing 11 antibody, F-box and WD-40 domain protein 11 antibody, F-box/WD repeat-containing protein 11 antibody, F-box and WD repeat domain containing 11b antibody, F-box and WD repeat domain containing 11a antibody, FBXW11 antibody, Fbxw11 antibody, LOC100199403 antibody, fbxw11b antibody, fbxw11a antibody
- Background
- FBXW11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.
- Molecular Weight
- 61 kDa (MW of target protein)
-