alpha Actinin 4 antibody (C-Term)
-
- Target See all alpha Actinin 4 (ACTN4) Antibodies
- alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This alpha Actinin 4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Alpha Actinin 4 antibody was raised against the C terminal of ACTN4
- Purification
- Affinity purified
- Immunogen
- alpha Actinin 4 antibody was raised using the C terminal of ACTN4 corresponding to a region with amino acids DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI
- Top Product
- Discover our top product ACTN4 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Alpha Actinin 4 Blocking Peptide, catalog no. 33R-2213, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))
- Alternative Name
- alpha Actinin 4 (ACTN4 Products)
- Synonyms
- fsgs antibody, fsgs1 antibody, C77391 antibody, ACTININ-4 antibody, FSGS antibody, FSGS1 antibody, wu:fb53f05 antibody, zgc:63508 antibody, actinin alpha 4 antibody, actinin, alpha 4 antibody, actinin alpha 4 S homeolog antibody, actn4 antibody, ACTN4 antibody, Actn4 antibody, actn4.S antibody
- Background
- Alpha actinins belong to the spectrin superfamily which is a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.
- Molecular Weight
- 105 kDa (MW of target protein)
- Pathways
- Proton Transport
-