Hsc70 antibody (N-Term)

Catalog No. ABIN631424

Product Details anti-Hsc70 Antibody

Target: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog, Drosophila melanogaster, C. elegans, Arabidopsis

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Hsc70 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HSPA8 antibody was raised against the N terminal of HSPA8

Purification: Affinity purified

Immunogen: HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPA8 Blocking Peptide, catalog no. 33R-6448, is also available for use as a blocking control in assays to test for specificity of this HSPA8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Hsc70

Target: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Alternative Name: HSPA8 (HSPA8 Products)

Synonyms: hsc54 antibody, hsc70 antibody, hsc71 antibody, hsp71 antibody, hsp73 antibody, hspa10 antibody, lap1 antibody, nip71 antibody, HSC54 antibody, HSC70 antibody, HSC71 antibody, HSP71 antibody, HSP73 antibody, HSPA10 antibody, LAP1 antibody, NIP71 antibody, Hsc70 antibody, 2410008N15Rik antibody, Hsc71 antibody, Hsc73 antibody, Hsp73 antibody, Hspa10 antibody, wu:fb01g06 antibody, wu:fi48b06 antibody, heat shock protein family A (Hsp70) member 8 L homeolog antibody, heat shock protein family A (Hsp70) member 8 antibody, heat shock 70kDa protein 8 antibody, heat shock protein 8 antibody, hspa8.L antibody, HSPA8 antibody, Hspa8 antibody, hspa8 antibody

Background: HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein. The protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.

Molecular Weight: 71 kDa (MW of target protein)