GSTM5 antibody (N-Term)
-
- Target See all GSTM5 Antibodies
- GSTM5 (Glutathione S-Transferase mu 5 (GSTM5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GSTM5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GSTM5 antibody was raised against the N terminal of GSTM5
- Purification
- Affinity purified
- Immunogen
- GSTM5 antibody was raised using the N terminal of GSTM5 corresponding to a region with amino acids MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK
- Top Product
- Discover our top product GSTM5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GSTM5 Blocking Peptide, catalog no. 33R-6298, is also available for use as a blocking control in assays to test for specificity of this GSTM5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTM5 (Glutathione S-Transferase mu 5 (GSTM5))
- Alternative Name
- GSTM5 (GSTM5 Products)
- Synonyms
- GSTM5-5 antibody, GTM5 antibody, glutathione S-transferase mu 5 antibody, glutathione S-transferase, mu 5 antibody, GSTM5 antibody, Gstm5 antibody
- Background
- Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.
- Molecular Weight
- 26 kDa (MW of target protein)
-