PPIL3 antibody
-
- Target See all PPIL3 Antibodies
- PPIL3 (Peptidylprolyl Isomerase (Cyclophilin)-Like 3 (PPIL3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPIL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR
- Top Product
- Discover our top product PPIL3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPIL3 Blocking Peptide, catalog no. 33R-6948, is also available for use as a blocking control in assays to test for specificity of this PPIL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPIL3 (Peptidylprolyl Isomerase (Cyclophilin)-Like 3 (PPIL3))
- Alternative Name
- PPIL3 (PPIL3 Products)
- Synonyms
- MGC89451 antibody, CYPJ antibody, Cyp10l antibody, 2310076N22Rik antibody, 2510026K04Rik antibody, peptidylprolyl isomerase like 3 antibody, peptidylprolyl isomerase (cyclophilin)-like 3 antibody, ppil3 antibody, PPIL3 antibody, Ppil3 antibody
- Background
- This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolylimide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants.
- Molecular Weight
- 18 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-