ME1 antibody
-
- Target See all ME1 Antibodies
- ME1 (Malic Enzyme 1, NADP(+)-Dependent, Cytosolic (ME1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ME1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL
- Top Product
- Discover our top product ME1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ME1 Blocking Peptide, catalog no. 33R-7695, is also available for use as a blocking control in assays to test for specificity of this ME1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ME1 (Malic Enzyme 1, NADP(+)-Dependent, Cytosolic (ME1))
- Alternative Name
- ME1 (ME1 Products)
- Synonyms
- HUMNDME antibody, MES antibody, D9Ertd267e antibody, Mdh-1 antibody, Mod-1 antibody, Mod1 antibody, MOD1 antibody, ME1 antibody, zgc:153079 antibody, malic enzyme 1 antibody, malic enzyme 1, NADP(+)-dependent, cytosolic antibody, ME1 antibody, Me1 antibody, me1 antibody
- Background
- ME1 is a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.
- Molecular Weight
- 64 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-