BBS5 antibody (Middle Region)
-
- Target See all BBS5 Antibodies
- BBS5 (Bardet-Biedl Syndrome 5 (BBS5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BBS5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BBS5 antibody was raised against the middle region of BBS5
- Purification
- Affinity purified
- Immunogen
- BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW
- Top Product
- Discover our top product BBS5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BBS5 Blocking Peptide, catalog no. 33R-9497, is also available for use as a blocking control in assays to test for specificity of this BBS5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BBS5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BBS5 (Bardet-Biedl Syndrome 5 (BBS5))
- Alternative Name
- BBS5 (BBS5 Products)
- Synonyms
- zgc:56578 antibody, 1700049I01Rik antibody, 2700023J09Rik antibody, Bardet-Biedl syndrome 5 antibody, Bardet-Biedl syndrome 5 (human) antibody, bbs5 antibody, BBS5 antibody, Bbs5 antibody
- Background
- BBS5 is a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Hedgehog Signaling
-