COG4 antibody (Middle Region)
-
- Target See all COG4 Antibodies
- COG4 (Component of Oligomeric Golgi Complex 4 (COG4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This COG4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- COG4 antibody was raised against the middle region of COG4
- Purification
- Affinity purified
- Immunogen
- COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR
- Top Product
- Discover our top product COG4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
COG4 Blocking Peptide, catalog no. 33R-9290, is also available for use as a blocking control in assays to test for specificity of this COG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COG4 (Component of Oligomeric Golgi Complex 4 (COG4))
- Alternative Name
- COG4 (COG4 Products)
- Synonyms
- COG4 antibody, DKFZp470I1314 antibody, CDG2J antibody, COD1 antibody, AW554810 antibody, D8Ertd515e antibody, zgc:136860 antibody, component of oligomeric golgi complex 4 antibody, COG4 antibody, cog4 antibody, Cog4 antibody
- Background
- Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4.
- Molecular Weight
- 89 kDa (MW of target protein)
-