SMARCD1 antibody (Middle Region)
-
- Target See all SMARCD1 Antibodies
- SMARCD1 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily D, Member 1 (SMARCD1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SMARCD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SMARCD1 antibody was raised against the middle region of Smarcd1
- Purification
- Affinity purified
- Immunogen
- SMARCD1 antibody was raised using the middle region of Smarcd1 corresponding to a region with amino acids RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ
- Top Product
- Discover our top product SMARCD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SMARCD1 Blocking Peptide, catalog no. 33R-8003, is also available for use as a blocking control in assays to test for specificity of this SMARCD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMARCD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMARCD1 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily D, Member 1 (SMARCD1))
- Alternative Name
- SMARCD1 (SMARCD1 Products)
- Synonyms
- rsc6p antibody, baf60a antibody, cracd1 antibody, MGC69403 antibody, BAF60A antibody, CRACD1 antibody, Rsc6p antibody, wu:fa10h07 antibody, wu:fb82d01 antibody, wu:fi45f10 antibody, AA407987 antibody, Baf60a antibody, D15Kz1 antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 L homeolog antibody, SMARCD1 antibody, smarcd1 antibody, smarcd1.L antibody, Smarcd1 antibody
- Background
- SMARCD1 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. It is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.
- Molecular Weight
- 58 kDa (MW of target protein)
-