SENP1 antibody (Middle Region)

Catalog No. ABIN631695

Product Details anti-SENP1 Antibody

Target: SENP1 (SUMO1/sentrin Specific Peptidase 1 (SENP1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SENP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SENP1 antibody was raised against the middle region of SENP1

Purification: Affinity purified

Immunogen: SENP1 antibody was raised using the middle region of SENP1 corresponding to a region with amino acids PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SENP1 Blocking Peptide, catalog no. 33R-7308, is also available for use as a blocking control in assays to test for specificity of this SENP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SENP1

Target: SENP1 (SUMO1/sentrin Specific Peptidase 1 (SENP1))

Alternative Name: SENP1 (SENP1 Products)

Synonyms: SuPr-2 antibody, 2310046A20Rik antibody, D15Ertd528e antibody, E330036L07Rik antibody, suPr-2 antibody, senp1 antibody, senp1a antibody, xsenp1 antibody, SENP1 antibody, Senp1 antibody, senp1b antibody, SUMO1/sentrin specific peptidase 1 antibody, SUMO1/sentrin specific peptidase 1 S homeolog antibody, sentrin/SUMO-specific protease 1 antibody, SUMO1/sentrin specific peptidase 1 L homeolog antibody, SENP1 antibody, Senp1 antibody, senp1.S antibody, senp1.L antibody, senp1 antibody

Background: The covalent modification of proteins by the small ubiquitin-like protein SUMO is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1.

Molecular Weight: 73 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity