Lipin 1 antibody (N-Term)

Catalog No. ABIN631777

Product Details anti-Lipin 1 Antibody

Target: Lipin 1 (LPIN1)

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Lipin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Lipin 1 antibody was raised against the N terminal of LPIN1

Purification: Affinity purified

Immunogen: Lipin 1 antibody was raised using the N terminal of LPIN1 corresponding to a region with amino acids SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lipin 1 Blocking Peptide, catalog no. 33R-8579, is also available for use as a blocking control in assays to test for specificity of this Lipin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Lipin 1

Target: Lipin 1 (LPIN1)

Alternative Name: Lipin 1 (LPIN1 Products)

Synonyms: LPIN1 antibody, pap1 antibody, PAP1 antibody, 4631420P06 antibody, Kiaa0188 antibody, Lipin1 antibody, fld antibody, mKIAA0188 antibody, zgc:194552 antibody, zgc:194558 antibody, lipin1 antibody, lipin 1 antibody, phosphatidate phosphatase LPIN1 antibody, LPIN1 antibody, lpin1 antibody, LOC100539289 antibody, Lpin1 antibody

Background: This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism.

Molecular Weight: 98 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process