THOC6 antibody
-
- Target See all THOC6 Antibodies
- THOC6 (THO Complex 6 Homolog (THOC6))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This THOC6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR
- Top Product
- Discover our top product THOC6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
THOC6 Blocking Peptide, catalog no. 33R-1196, is also available for use as a blocking control in assays to test for specificity of this THOC6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THOC6 (THO Complex 6 Homolog (THOC6))
- Alternative Name
- THOC6 (THOC6 Products)
- Synonyms
- WDR58 antibody, fSAP35 antibody, F830014G06Rik antibody, Wdr58 antibody, Pdrp antibody, zgc:101618 antibody, thoc6 antibody, THO complex 6 antibody, THO complex 6 homolog (Drosophila) antibody, THO complex 6 L homeolog antibody, THOC6 antibody, Thoc6 antibody, thoc6 antibody, thoc6.L antibody
- Background
- THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.
- Molecular Weight
- 37 kDa (MW of target protein)
-