TSGA13 antibody (Middle Region)
-
- Target See all TSGA13 products
- TSGA13 (Testis Specific, 13 (TSGA13))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TSGA13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TSGA13 antibody was raised against the middle region of TSGA13
- Purification
- Affinity purified
- Immunogen
- TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TSGA13 Blocking Peptide, catalog no. 33R-1503, is also available for use as a blocking control in assays to test for specificity of this TSGA13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSGA13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSGA13 (Testis Specific, 13 (TSGA13))
- Alternative Name
- TSGA13 (TSGA13 Products)
- Synonyms
- 1700023D02Rik antibody, Vme1 antibody, testis specific gene A13 antibody, testis specific 13 antibody, Tsga13 antibody, TSGA13 antibody
- Background
- The specific function of TSGA13 is not yet known.
- Molecular Weight
- 32 kDa (MW of target protein)
-