TSGA13 antibody (Middle Region)

Catalog No. ABIN631851

Product Details anti-TSGA13 Antibody

Target: TSGA13 (Testis Specific, 13 (TSGA13))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSGA13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TSGA13 antibody was raised against the middle region of TSGA13

Purification: Affinity purified

Immunogen: TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TSGA13 Blocking Peptide, catalog no. 33R-1503, is also available for use as a blocking control in assays to test for specificity of this TSGA13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSGA13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSGA13

Target: TSGA13 (Testis Specific, 13 (TSGA13))

Alternative Name: TSGA13 (TSGA13 Products)

Synonyms: 1700023D02Rik antibody, Vme1 antibody, testis specific gene A13 antibody, testis specific 13 antibody, Tsga13 antibody, TSGA13 antibody

Background: The specific function of TSGA13 is not yet known.

Molecular Weight: 32 kDa (MW of target protein)