UBQLN4 antibody (Middle Region)
-
- Target See all UBQLN4 Antibodies
- UBQLN4 (Ubiquilin 4 (UBQLN4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBQLN4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Ubiquilin 4 antibody was raised against the middle region of UBQLN4
- Purification
- Affinity purified
- Immunogen
- Ubiquilin 4 antibody was raised using the middle region of UBQLN4 corresponding to a region with amino acids TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS
- Top Product
- Discover our top product UBQLN4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Ubiquilin 4 Blocking Peptide, catalog no. 33R-9011, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBQLN4 (Ubiquilin 4 (UBQLN4))
- Alternative Name
- Ubiquilin 4 (UBQLN4 Products)
- Synonyms
- a1u antibody, cip75 antibody, ubin antibody, ubiquilin-4 antibody, A1U antibody, A1Up antibody, C1orf6 antibody, CIP75 antibody, UBIN antibody, A1u antibody, AI663987 antibody, RGD1308273 antibody, ubiquilin 4 L homeolog antibody, ubiquilin 4 antibody, ubqln4.L antibody, ubqln4 antibody, UBQLN4 antibody, Ubqln4 antibody
- Background
- The function of Ubiquilin 4 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 64 kDa (MW of target protein)
-