RAD23B antibody

Catalog No. ABIN631882

Product Details anti-RAD23B Antibody

Target: RAD23B (RAD23 Homolog B (RAD23B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD23B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RAD23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD23B Blocking Peptide, catalog no. 33R-7658, is also available for use as a blocking control in assays to test for specificity of this RAD23B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD23B

Target: RAD23B (RAD23 Homolog B (RAD23B))

Alternative Name: RAD23B (RAD23B Products)

Synonyms: HHR23B antibody, HR23B antibody, P58 antibody, 0610007D13Rik antibody, AV001138 antibody, mHR23B antibody, p58 antibody, MGC107846 antibody, zgc:65951 antibody, RAD23 homolog B, nucleotide excision repair protein antibody, UV excision repair protein RAD23 homolog B antibody, RAD23 homolog B, nucleotide excision repair protein S homeolog antibody, RAD23B antibody, Rad23b antibody, rd23b antibody, rad23b antibody, rad23b.S antibody

Background: The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER).

Molecular Weight: 43 kDa (MW of target protein)

Pathways: DNA Damage Repair