CSNK2A1/CK II alpha antibody (C-Term)
-
- Target See all CSNK2A1/CK II alpha (CSNK2A1) Antibodies
- CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CSNK2A1/CK II alpha antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CK2 alpha antibody was raised against the C terminal of CSNK2 A2
- Purification
- Affinity purified
- Immunogen
- CK2 alpha antibody was raised using the C terminal of CSNK2 A2 corresponding to a region with amino acids LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
- Top Product
- Discover our top product CSNK2A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CK2 alpha Blocking Peptide, catalog no. 33R-5122, is also available for use as a blocking control in assays to test for specificity of this CK2 alpha antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))
- Alternative Name
- CK2 alpha (CSNK2A1 Products)
- Synonyms
- CK2A2 antibody, CSNK2A1 antibody, CK2A1 antibody, CKII antibody, CSNK2A3 antibody, CK2A antibody, Ck2a antibody, BmCK2a antibody, wu:fi38e04 antibody, wu:fi38h03 antibody, csnk2a1 antibody, CK-II antibody, CK2 antibody, Ckiialpha antibody, Csnk2a1-rs4 antibody, ck2a1 antibody, casein kinase 2 alpha 2 antibody, casein kinase 2 alpha 1 antibody, casein kinase 2 alpha subunit antibody, casein kinase 2, alpha 1 polypeptide antibody, CK2 protein kinase alpha 2 antibody, casein kinase II alpha subunit antibody, Casein kinase II alpha subunit antibody, casein kinase 2, alpha 1 polypeptide S homeolog antibody, CSNK2A2 antibody, CSNK2A1 antibody, ck2a antibody, Ck2a antibody, csnk2a1 antibody, cka2 antibody, Ckiialpha antibody, CK2A1 antibody, Csnk2a1 antibody, csnk2a1.S antibody
- Background
- CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-