ACTR3 antibody

Catalog No. ABIN631909

Product Details anti-ACTR3 Antibody

Target: ACTR3 (ARP3 Actin-Related Protein 3 (ACTR3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTR3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ACTR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTR3 Blocking Peptide, catalog no. 33R-3891, is also available for use as a blocking control in assays to test for specificity of this ACTR3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTR3

Target: ACTR3 (ARP3 Actin-Related Protein 3 (ACTR3))

Alternative Name: ACTR3 (ACTR3 Products)

Synonyms: ARP3 antibody, 1200003A09Rik antibody, Arp3 antibody, DDBDRAFT_0218534 antibody, DDBDRAFT_0219936 antibody, DDB_0218534 antibody, DDB_0219936 antibody, actr3 antibody, MGC53892 antibody, ACTR3 antibody, ACTIN-RELATED PROTEIN 3 antibody, ARABIDOPSIS THALIANA ACTIN-RELATED PROTEIN 3 antibody, ATARP3 antibody, DISTORTED TRICHOMES 1 antibody, F3F19.20 antibody, F3F19_20 antibody, ARP3 actin related protein 3 homolog antibody, ARP3 actin-related protein 3 antibody, actin-like protein 3 antibody, Actin-like protein 3 antibody, actin related protein 3 antibody, ARP3 actin-related protein 3 homolog S homeolog antibody, Actin-like ATPase superfamily protein antibody, ACTR3 antibody, Actr3 antibody, Tb09.160.3850 antibody, TVAG_371880 antibody, arpC antibody, LOC100281262 antibody, actr3.S antibody, actr3 antibody, DIS1 antibody

Background: The specific function of this gene has not yet been determined, however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: RTK Signaling, Regulation of Actin Filament Polymerization