KIFAP3 antibody (Middle Region)

Catalog No. ABIN631960

Product Details anti-KIFAP3 Antibody

Target: KIFAP3 (Kinesin Associated Protein 3 (KIFAP3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIFAP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIFAP3 antibody was raised against the middle region of KIFAP3

Purification: Affinity purified

Immunogen: KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIFAP3 Blocking Peptide, catalog no. 33R-9969, is also available for use as a blocking control in assays to test for specificity of this KIFAP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIFAP3

Target: KIFAP3 (Kinesin Associated Protein 3 (KIFAP3))

Alternative Name: KIFAP3 (KIFAP3 Products)

Synonyms: CG11759 antibody, DmKAP antibody, DmKap antibody, Dmel\\CG11759 antibody, KAP antibody, KAP3 antibody, Kap antibody, dKAP3 antibody, kap3 antibody, FLA3 antibody, KAP-1 antibody, KAP-3 antibody, SMAP antibody, Smg-GDS antibody, dJ190I16.1 antibody, fb99h08 antibody, kifap3 antibody, wu:fb99h08 antibody, wz7228 antibody, Kinesin associated protein 3 antibody, kinesin-associated protein 3 antibody, kinesin associated protein 3 antibody, kinesin-associated protein 3b antibody, kinesin-associated protein 3 L homeolog antibody, Kap3 antibody, LOC551999 antibody, KIFAP3 antibody, Kifap3 antibody, kifap3b antibody, kifap3.L antibody

Background: The protein encoded by this gene contains 9 'Armadillo' repeats and interacts with the smg GDS protein through these repeats. This protein, which is highly concentrated around the endoplasmic reticulum, is phosphorylated by v-src, and this phosphorylation reduces the affinity of the protein for smg GDS. It is thought that this protein serves as a linker between human chromosome-associated polypeptide (HCAP) and KIF3A/B, a kinesin superfamily protein in the nucleus, and that it plays a role in the interaction of chromosomes with an ATPase motor protein.

Molecular Weight: 91 kDa (MW of target protein)

Pathways: Hedgehog Signaling, Sensory Perception of Sound