KIFAP3 antibody (Middle Region)
-
- Target See all KIFAP3 Antibodies
- KIFAP3 (Kinesin Associated Protein 3 (KIFAP3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIFAP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIFAP3 antibody was raised against the middle region of KIFAP3
- Purification
- Affinity purified
- Immunogen
- KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG
- Top Product
- Discover our top product KIFAP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIFAP3 Blocking Peptide, catalog no. 33R-9969, is also available for use as a blocking control in assays to test for specificity of this KIFAP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFAP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIFAP3 (Kinesin Associated Protein 3 (KIFAP3))
- Alternative Name
- KIFAP3 (KIFAP3 Products)
- Synonyms
- CG11759 antibody, DmKAP antibody, DmKap antibody, Dmel\\CG11759 antibody, KAP antibody, KAP3 antibody, Kap antibody, dKAP3 antibody, kap3 antibody, FLA3 antibody, KAP-1 antibody, KAP-3 antibody, SMAP antibody, Smg-GDS antibody, dJ190I16.1 antibody, fb99h08 antibody, kifap3 antibody, wu:fb99h08 antibody, wz7228 antibody, Kinesin associated protein 3 antibody, kinesin-associated protein 3 antibody, kinesin associated protein 3 antibody, kinesin-associated protein 3b antibody, kinesin-associated protein 3 L homeolog antibody, Kap3 antibody, LOC551999 antibody, KIFAP3 antibody, Kifap3 antibody, kifap3b antibody, kifap3.L antibody
- Background
- The protein encoded by this gene contains 9 'Armadillo' repeats and interacts with the smg GDS protein through these repeats. This protein, which is highly concentrated around the endoplasmic reticulum, is phosphorylated by v-src, and this phosphorylation reduces the affinity of the protein for smg GDS. It is thought that this protein serves as a linker between human chromosome-associated polypeptide (HCAP) and KIF3A/B, a kinesin superfamily protein in the nucleus, and that it plays a role in the interaction of chromosomes with an ATPase motor protein.
- Molecular Weight
- 91 kDa (MW of target protein)
- Pathways
- Hedgehog Signaling, Sensory Perception of Sound
-