MELK antibody (Middle Region)
-
- Target See all MELK Antibodies
- MELK (Maternal Embryonic Leucine Zipper Kinase (MELK))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MELK antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MELK antibody was raised against the middle region of MELK
- Purification
- Affinity purified
- Immunogen
- MELK antibody was raised using the middle region of MELK corresponding to a region with amino acids AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIK
- Top Product
- Discover our top product MELK Primary Antibody
-
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 637-651) antibody
MELK Reactivity: Human ELISA, IHC, ICC, FACS Host: Mouse Monoclonal 2G2 unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) antibodyMELK Reactivity: Human ELISA, IF, IHC, FACS Host: Mouse Monoclonal 2G2 unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 637-651) antibodyMELK Reactivity: Human ELISA, IHC, FACS, IF/ICC Host: Mouse Monoclonal unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 434-468), (C-Term) antibodyMELK Reactivity: Mouse WB, FACS Host: Rabbit Polyclonal RB51204 unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) antibodyMELK Reactivity: Human IF, IHC (p), EIA Host: Mouse Monoclonal 2G2 unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 525-554), (C-Term) antibodyMELK Reactivity: Human WB Host: Rabbit Polyclonal RB8557 unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (Center) antibodyMELK Reactivity: Human, Mouse, Rat, Monkey WB, IF, IHC, IC Host: Rabbit Polyclonal unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) antibodyMELK Reactivity: Human WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 101-250) antibodyMELK Reactivity: Human ELISA, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 381-415) antibodyMELK Reactivity: Mouse WB Host: Rabbit Polyclonal RB51207 unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MELK Blocking Peptide, catalog no. 33R-1602, is also available for use as a blocking control in assays to test for specificity of this MELK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MELK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MELK (Maternal Embryonic Leucine Zipper Kinase (MELK))
- Alternative Name
- MELK (MELK Products)
- Synonyms
- MELK antibody, xmelk antibody, Melk antibody, HPK38 antibody, AI327312 antibody, MPK38 antibody, mKIAA0175 antibody, fb71b01 antibody, fe01f04 antibody, wu:fb71b01 antibody, wu:fe01f04 antibody, maternal embryonic leucine zipper kinase antibody, maternal embryonic leucine zipper kinase L homeolog antibody, MELK antibody, melk antibody, cgd5_2270 antibody, Melk antibody, melk.L antibody
- Background
- The protein MELK phosphorylates ZNF622 and may contribute to its redirection to the nucleus. Also it may be involved in the inhibition of spliceosome assembly during mitosis.
- Molecular Weight
- 75 kDa (MW of target protein)
-
