FBXO34 antibody (Middle Region)
-
- Target See all FBXO34 Antibodies
- FBXO34 (F-Box Protein 34 (FBXO34))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXO34 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXO34 antibody was raised against the middle region of FBXO34
- Purification
- Affinity purified
- Immunogen
- FBXO34 antibody was raised using the middle region of FBXO34 corresponding to a region with amino acids ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP
- Top Product
- Discover our top product FBXO34 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXO34 Blocking Peptide, catalog no. 33R-2722, is also available for use as a blocking control in assays to test for specificity of this FBXO34 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO34 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO34 (F-Box Protein 34 (FBXO34))
- Alternative Name
- FBXO34 (FBXO34 Products)
- Synonyms
- Fbx34 antibody, 2900057B08Rik antibody, 5830426G16Rik antibody, FBXO34 antibody, F-box protein 34 antibody, F-box protein 34 L homeolog antibody, FBXO34 antibody, Fbxo34 antibody, fbxo34.L antibody, fbxo34 antibody
- Background
- Members of the F-box protein family, such as FBXO34, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
- Molecular Weight
- 79 kDa (MW of target protein)
-