ACTR3B antibody
-
- Target See all ACTR3B Antibodies
- ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACTR3B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ACTR3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR
- Top Product
- Discover our top product ACTR3B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACTR3B Blocking Peptide, catalog no. 33R-1986, is also available for use as a blocking control in assays to test for specificity of this ACTR3B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))
- Alternative Name
- ACTR3B (ACTR3B Products)
- Synonyms
- RGD1565759 antibody, ARP11 antibody, ARP3BETA antibody, 9630005C02 antibody, AW047569 antibody, Arp3b antibody, Arp3beta antibody, ARP3 actin related protein 3 homolog B antibody, ARP3 actin-related protein 3B antibody, Actr3b antibody, ACTR3B antibody
- Background
- ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-