Endoplasmic Reticulum Protein 44 (ERP44) antibody

Details for Product No. ABIN632154
Target
Reactivity
Human, Mouse, Rat
38
6
5
3
3
3
3
3
3
3
2
2
2
2
1
1
1
Host
Rabbit
24
8
7
Clonality
Polyclonal
Conjugate
Un-conjugated
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
26
18
11
10
8
3
1
1
1
Options
Immunogen TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE
Purification Affinity purified
Target
Alternative Name TXNDC4 (ERP44 Antibody Abstract)
Background TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
Molecular Weight 45 kDa (MW of target protein)
Pathways Cell RedoxHomeostasis, SARS-CoV-2 Protein Interactome
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TXNDC4 Blocking Peptide, catalog no. 33R-5025, is also available for use as a blocking control in assays to test for specificity of this TXNDC4 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-Endoplasmic Reticulum Protein 44 (ERP44) antibody (ABIN632154) TXNDC4 antibody used at 1 ug/ml to detect target protein.