Endoplasmic Reticulum Protein 44 (ERP44) (AA 1-406) antibody

Details for Product No. ABIN524951
Target
Binding Specificity
AA 1-406
11
4
3
2
1
1
1
1
1
Reactivity
Human
38
7
6
3
3
3
3
3
3
3
2
2
2
2
1
1
1
Host
Rabbit
24
8
7
Clonality
Polyclonal
Conjugate
Un-conjugated
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
26
18
11
10
8
3
1
1
1
Options
Purpose Rabbit polyclonal antibody raised against a full-length human TXNDC4 protein.
Brand MaxPab®
Immunogen

immunogen: TXNDC4 (NP_055866.1, 1 a.a. ~ 406 a.a) full-length human protein.

Immunogen Sequence: MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL

Cross-Reactivity Human, Mouse (Murine)
Target
Alternative Name TXNDC4 (ERP44 Antibody Abstract)
Background Full Gene Name: thioredoxin domain containing 4 (endoplasmic reticulum)
Synonyms: ERP44,KIAA0573
Gene ID 23071
NCBI Accession NP_055866, NM_015051
Pathways Cell RedoxHomeostasis, SARS-CoV-2 Protein Interactome
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 1-406) antibody (ABIN524951) TXNDC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression ...
Image no. 2 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 1-406) antibody (ABIN524951) TXNDC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression ...
Image no. 3 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 1-406) antibody (ABIN524951) TXNDC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression ...
Image no. 4 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 1-406) antibody (ABIN524951) Western Blot analysis of TXNDC4 expression in transfected 293T cell line by TXNDC4 Ma...
Image no. 5 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 1-406) antibody (ABIN524951) TXNDC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression ...
Image no. 6 for anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 1-406) antibody (ABIN524951) TXNDC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression ...